PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G229300.1
Common NameB456_006G229300, LOC105800441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family DBB
Protein Properties Length: 239aa    MW: 26206.8 Da    PI: 4.7704
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G229300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.35.5e-07444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         C+ +e+ +++  C  ++  lC++C  e H        H++
  Gorai.006G229300.1  4 QCDVCERAPATVICCADEAALCAKCDIEVHAAnklaskHQR 44
                        7*****************************65667777765 PP

2zf-B_box26.71.2e-085385234
            zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
                        + + C+ ++ek + +fC +++ l+C+dC + +H
  Gorai.006G229300.1 53 KLPPCDICQEKAAFIFCVEDRALFCRDCDEPIH 85
                        6789**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.3147IPR000315B-box-type zinc finger
CDDcd000211.28E-6347No hitNo description
PfamPF006432.8E-5444IPR000315B-box-type zinc finger
SMARTSM003361.5E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501199.0445299IPR000315B-box-type zinc finger
SMARTSM003361.3E-145299IPR000315B-box-type zinc finger
PfamPF006431.4E-65394IPR000315B-box-type zinc finger
CDDcd000212.10E-75598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKIQCDVCER APATVICCAD EAALCAKCDI EVHAANKLAS KHQRLLLQCL SNKLPPCDIC  60
QEKAAFIFCV EDRALFCRDC DEPIHPAGSL AANHQRFLAT GIRVALSSSC NKNTENNVLE  120
PPNKSAPQTS MKMPAHQQHS SFSSPWAVDD LLELSDIQSL NKKEHSELGE LEWLADIGLF  180
GDQLPQEALA AAEVPQLPIS QSSSTNLYRP TKYSMALKKP RIETPDEDDE FFTVPDLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.6560.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487794200.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5247550.0HQ524755.1 Gossypium herbaceum clone NBRI_A2_3787-1 simple sequence repeat marker, mRNA sequence.
GenBankHQ5255210.0HQ525521.1 Gossypium herbaceum clone NBRI_A2_3787-2 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487043.11e-176PREDICTED: B-box zinc finger protein 24-like
SwissprotQ962881e-98BBX24_ARATH; B-box zinc finger protein 24
TrEMBLA0A0D2T2Y81e-176A0A0D2T2Y8_G
TrEMBLA0A0B0NVU91e-176A0A0B0NVU9_G
STRINGPOPTR_0017s05700.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27112767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.11e-100DBB family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]